PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009601374.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 278aa    MW: 32005.1 Da    PI: 5.6164
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009601374.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding452.5e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEd++l+  ++  G g+W++ ++  g+ R++k+c++rw +yl
   XP_009601374.1 14 KGPWIPEEDQILISFIQTNGHGNWRALPKQAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding55.51.4e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
   XP_009601374.1  67 RGNFTKEEEETIIQLHEMLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.352961IPR017930Myb domain
SuperFamilySSF466892.97E-2910108IPR009057Homeodomain-like
SMARTSM007174.9E-111363IPR001005SANT/Myb domain
PfamPF002492.1E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-231568IPR009057Homeodomain-like
CDDcd001672.85E-81661No hitNo description
PROSITE profilePS5129426.90362116IPR017930Myb domain
SMARTSM007171.1E-1566114IPR001005SANT/Myb domain
PfamPF002493.0E-1667112IPR001005SANT/Myb domain
CDDcd001673.49E-1169112No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2769116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MVRAPCCEKM GLKKGPWIPE EDQILISFIQ TNGHGNWRAL PKQAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF TKEEEETIIQ LHEMLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKKLKDYK  120
PPQNSKRHSK SKNHDSKGPT TSESSNNSDL TIINTQKHID SPVLAPNSPQ ISSSTEMSTV  180
TLVDDHQMVV IKQEVMESSE YFPEIDESFW TDELTTDNNW SSTDHVMVAA NQELQVQLPF  240
SSFKEENVDI LATKMEDDMD FWYNVFIKTD DLPELPEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-27121162105MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-27121162105C-Myb DNA-Binding Domain
1msf_C4e-27121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0286510.0AB028651.1 Nicotiana tabacum mRNA for myb-related transcription factor LBM3, complete cds.
GenBankNTU727620.0U72762.1 Nicotiana tabacum transcription factor Myb1 (myb1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009601374.10.0PREDICTED: myb-related protein Myb4-like
RefseqXP_016493387.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLP933910.0P93391_TOBAC; Myb-related transcription factor LBM3
STRINGSolyc06g053610.2.11e-136(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.14e-91myb domain protein 15